SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94972258|ref|YP_594298.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94972258|ref|YP_594298.1|
Domain Number 1 Region: 45-271
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0000706
Family YVTN repeat 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94972258|ref|YP_594298.1|
Sequence length 294
Comment hypothetical protein Dgeo_2792 [Deinococcus geothermalis DSM 11300]
Sequence
MAQALTSLSFKGTISTEVLTDTSALIVKYSRGINNICEVALPTLKSIRCLSVMDNRNLIV
DSNRMGTAVIMNGSSGMLVWRSGKPARRLPLIYDWTRISDDGNSFLHSGLKTLEQRSING
ILIKAIPIGLMGTISRGAQIFDYSLSNGSIYVSNLNGLYIFNDKGGTREFKTTQPLRSFK
ISRGLVVAVSNSFLKIISMKENSLRDKASIKISRQALLGQSTFDICGNYILTTLDGQSIS
LLDFSLTTKRRFVIPEKFTVASLSCTKNGAIGLVLLQKTPLTEDEVRLQVLQLR
Download sequence
Identical sequences Q1J2R0
319795.Dgeo_2792 WP_011525781.1.71355 gi|94972258|ref|YP_594298.1| gi|94972258|ref|YP_594298.1|NC_008010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]