SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94984131|ref|YP_603495.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94984131|ref|YP_603495.1|
Domain Number 1 Region: 9-109
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000212
Family Thioredoxin-like 2Fe-2S ferredoxin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94984131|ref|YP_603495.1|
Sequence length 111
Comment hypothetical protein Dgeo_0022 [Deinococcus geothermalis DSM 11300]
Sequence
MPPKFFPTRGHLLVCQGQNCQARGSALLYKALWNHLERAALAYYKQGGSVRLTESGCLGA
CSFGPALCVYRHRGGELEEGWYAAADFPLAAKVAQAVHEEAPLPEDRKYGP
Download sequence
Identical sequences Q1J2F8
WP_011529173.1.71355 319795.Dgeo_0022 gi|94984131|ref|YP_603495.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]