SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94984207|ref|YP_603571.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94984207|ref|YP_603571.1|
Domain Number 1 Region: 73-336
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 1.7e-64
Family MurCDEF 0.00026
Further Details:      
 
Domain Number 2 Region: 328-485
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 5.23e-34
Family MurCDEF C-terminal domain 0.00036
Further Details:      
 
Domain Number 3 Region: 2-99
Classification Level Classification E-value
Superfamily MurE/MurF N-terminal domain 5.89e-19
Family MurE/MurF N-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94984207|ref|YP_603571.1|
Sequence length 488
Comment UDP-N-acetylmuramyl-tripeptide synthetases [Deinococcus geothermalis DSM 11300]
Sequence
MRLPDLAAALSTPTPPLPDVEVRGVTHHAAWVEPGFLFVAIRGARFDGHSFLPEVAARGA
VAVLGEGLPADVASPLPYLSVPNARAALADAAAALAGHPSRALKVVGVTGTDGKTTTSWL
TRHLLRAAGLRTGLLSTVGYELPDGVLRHFPAHFTTPEAPQVQTTLRALLEAGGEAAVLE
ASSHALALDRVRGVDWDVAVWTHLSSEHLDFHGTLENYFADKRKLIERAPFAVLNVDDPW
TAQLRGVAPQETTYSAENQHADWQARHIEERATGLHFQVASPLGEFAAHLPMIGRFNVAN
ALAGMAAAAQLGATVPQLVEGLASFRGVPGRMELVPGGASDPRVIVDFAHTPPSLEKALT
TLRATTGGRLWVLLGSAGGPRDPGKRAPLGEVATRLADHAVFTEEDCRDTPLWDILREME
RGAREAGRNNFTSIEDRREAIRFVIREARPGDTVLLAGKGPEDTLERNGEVIAWNEVEEA
REALAARA
Download sequence
Identical sequences Q1J282
WP_011529249.1.71355 319795.Dgeo_0099 gi|94984207|ref|YP_603571.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]