SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94984235|ref|YP_603599.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94984235|ref|YP_603599.1|
Domain Number 1 Region: 12-117
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.0000000323
Family Ferredoxin reductase FAD-binding domain-like 0.022
Further Details:      
 
Weak hits

Sequence:  gi|94984235|ref|YP_603599.1|
Domain Number - Region: 180-230
Classification Level Classification E-value
Superfamily Aspartate/glutamate racemase 0.085
Family Aspartate/glutamate racemase 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94984235|ref|YP_603599.1|
Sequence length 266
Comment siderophore-interacting protein [Deinococcus geothermalis DSM 11300]
Sequence
MTTSSSRPTRPAPRLLHVRAKAQLTPNLLRLTLAGDLHDFGSGHTFKLLIVPRGTSALPL
PDAAPRPVVRTFTVRTLDRAAGELTVDMVLHGGFAAQWAWQAEPGDPVGVVGPLGAPLPR
TAGPYLIAGDHCALPAIARILEELPHDATGNVLIEVPGPADELPLIRPPGLRLRWLHRTG
TADDETLLQDAVRALTPLPQTPTSFVWIACESASVKALRAYLREELGWPPQQMQLAGYWK
RGVDERTYHDTAHYDHAPDEYGRGRG
Download sequence
Identical sequences Q1J254
WP_011529277.1.71355 319795.Dgeo_0127 gi|94984235|ref|YP_603599.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]