SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94984273|ref|YP_603637.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94984273|ref|YP_603637.1|
Domain Number 1 Region: 128-301
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.79e-42
Family Single strand DNA-binding domain, SSB 0.00000536
Further Details:      
 
Domain Number 2 Region: 3-130
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.43e-31
Family Single strand DNA-binding domain, SSB 0.000000975
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94984273|ref|YP_603637.1|
Sequence length 301
Comment single-strand binding protein [Deinococcus geothermalis DSM 11300]
Sequence
MARGMNHVFLIGALARDPELRYTPSGVAVFEATVAGEDHLIGNDGRERKLPWYHRVSLLG
KPAEWQAERNLRAGDAVMVEGGLEYSQWEAPEGGKRSMVRVKAGRIEQLGSQPELVQDAG
GGVRMAGGLNEVILIGNVTRDPELRYTPAGDAVLGLGLAVNESWQDRQGQRQEKTHWVDV
TLWRDLAEAMKDLRKGDPVLVQGRLVNEAWTDRDGNKRNSTKVEATRVEALSRGAATGSA
AATPAAPRTQTAGSTARPQPSSVGVSRTQPSRAANTGTRSGGLDIDQGLDDFPPEEEDLP
F
Download sequence
Identical sequences Q1J216
319795.Dgeo_0165 gi|94984273|ref|YP_603637.1| WP_011529315.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]