SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94984331|ref|YP_603695.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94984331|ref|YP_603695.1|
Domain Number 1 Region: 86-335
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.25e-72
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000346
Further Details:      
 
Domain Number 2 Region: 6-92
Classification Level Classification E-value
Superfamily tRNA-binding arm 2.35e-19
Family Phenylalanyl-tRNA synthetase (PheRS) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94984331|ref|YP_603695.1|
Sequence length 339
Comment phenylalanyl-tRNA synthetase subunit alpha [Deinococcus geothermalis DSM 11300]
Sequence
MREEALQAIQEAPDLPALQAVKTRYLGKSGLVTRELGALGKLPPEERKRRGAELNALRQA
IDAALTEREAVLKRAALDARLASEAIDVTLPGLSLPAGGLHPISRVYDDLIRIFERMGYA
VVEGPEVEDEHHNFEALNVPWYHPARDLQDTFWLEDGRLLRTHTSPMQVRYMVDHEPPLK
VVVRGKVYRYEATDATHESMFHQLEGLVVGDGISMADLKGTVAELARGLYGPSAKVRFQP
SYYPFVEPGADFAVWWDNPRGESKWLELGGCGMVHPNVFRAVDDLREAAGKPRVYEGKTG
FAFGLGPERIAMLKYGIPDIRYFYANDPRVIGQFRGELG
Download sequence
Identical sequences Q1J1V8
WP_011529373.1.71355 319795.Dgeo_0223 gi|94984331|ref|YP_603695.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]