SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94984332|ref|YP_603696.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94984332|ref|YP_603696.1|
Domain Number 1 Region: 225-431
Classification Level Classification E-value
Superfamily PheT/TilS domain 5.49e-51
Family B3/B4 domain of PheRS, PheT 0.0000152
Further Details:      
 
Domain Number 2 Region: 500-713
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.43e-36
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000395
Further Details:      
 
Domain Number 3 Region: 721-812
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 6.93e-22
Family Anticodon-binding domain of PheRS 0.00011
Further Details:      
 
Domain Number 4 Region: 439-508
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 1.46e-18
Family Domains B1 and B5 of PheRS-beta, PheT 0.001
Further Details:      
 
Domain Number 5 Region: 42-193
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.03e-17
Family Myf domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94984332|ref|YP_603696.1|
Sequence length 819
Comment phenylalanyl-tRNA synthetase subunit beta [Deinococcus geothermalis DSM 11300]
Sequence
MKLPYSWLKELVPQLPPVQDLEPILANMGLPLEGIEEVPAPPEGVLLAAVTAAEPIEGTQ
LTQLTLDVGPHGSKTVASGAPNAAGLPAGTMVALVTPGTRLGDTVYGVRSLQGVESWGMA
ASAKELGIGETSTGLLLFPAGTAAPGTPLYELWAADSVLDVEVTPNRADVLSALGLARDL
AAFLRLDLVQPEAGPPPSGEGEIRVTLPPRGVTLERDPSRKLRFGCDHFAARTVSGVRNG
PSPLWMQRRLTLSGMRPIDLIVDTSNYVMLELGQPTALYDRRDVVDDQIIVSFGLRQGEV
VRDLLGNEHLVGPEDLLIRDGREVTIPTVAEAFAAAGQPKPGVGILGIAGIVGGDHGQVR
ADTSDVVIESAHFDPVLLRRTSTRLGLKTDAVYRFERGVDPLLAPRGANRVAGLLAQFGG
GQAHPGATLVGQPEVPGPIEATGDQIRALLGMEVGTDEMVDILTRLGCRVEREDDHLSVT
PPSWRVDLTIWQDVAEEVARLHGYAHLPETLPTLRVHESNLGAEQASQDRAGLRRTLSGL
GFQEVVTYTFTNDEEAVRARSERPGVRLRNPLTADRTALRTALYPSLLKAAQVHPKGERV
LLFELGRVFPAAGETERLGLLMRGPLAPQTYAPGVAGSFAVFKGLVEALAGSLGANLEVR
QLRGDAVPAALHPGIAGEVVWNGVTVGWLGALHPEVAQDFGLQGDTFLLEVGLPLPGRSW
SFRDPSRAPAAWRDLAVITPQEVSYGDIAALLRREAGELLESVEPFDVYVGAPIPEGQRS
VAVRLVFRGERTLTDAEVDPIMERLMGAVRAQGWSIREK
Download sequence
Identical sequences Q1J1V7
319795.Dgeo_0224 WP_011529374.1.71355 gi|94984332|ref|YP_603696.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]