SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94984400|ref|YP_603764.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94984400|ref|YP_603764.1|
Domain Number 1 Region: 1-297
Classification Level Classification E-value
Superfamily Arginase/deacetylase 8.1e-89
Family Arginase-like amidino hydrolases 0.000000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94984400|ref|YP_603764.1|
Sequence length 299
Comment arginase [Deinococcus geothermalis DSM 11300]
Sequence
MNVHILGIPMDLGAGRRGVDMGPSALRNAHLAARLRELGHTVHDRGDVDVALPETLDKHA
SAGLVFLEPILEACRSAAERLAALPGDVFPITLGGDHSVSMGTVTGNARRGNSAGERTGL
IWVDAHTDYNTPESSPSGNIHGMPVAHLTGLGDPALAGLGDGWHLRPEDIVMIGIRSVDA
RERDLLRAAGIKAYTMKEVDQLGITRITEETLERLGDVTRLHVSFDADALDPSVAPGVGT
PVPGGLTYREGHLLMELLSESGRVTSLDIVEVNPVLDTRNQTAEVMVGMAASLLGQRIL
Download sequence
Identical sequences Q1J1N9
WP_011529440.1.71355 319795.Dgeo_0292 gi|94984400|ref|YP_603764.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]