SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94984409|ref|YP_603773.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94984409|ref|YP_603773.1|
Domain Number 1 Region: 91-202
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 3.91e-29
Family Riboflavin synthase 0.00033
Further Details:      
 
Domain Number 2 Region: 1-88
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 5.61e-22
Family Riboflavin synthase 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94984409|ref|YP_603773.1|
Sequence length 214
Comment riboflavin synthase subunit alpha [Deinococcus geothermalis DSM 11300]
Sequence
MFTGIVEQVGRVARAEERGGTLTVTVTPERLWPDLELGESIAVNGTCLTVTGWDETGFTA
DLSRETLKKTAPNWHVGAHLNLERAMTAAARFGGHVVSGHVDGIGEILEVREDSGSCTVT
VRAAPHLARYLVPKGSVTVDGVSLTVVDTGGPGGSRTDLAPNEFTLWLVPHTLAVTTLGG
WRKGTVVNLEADQLAKYVERLLLMRDFGRAEVGA
Download sequence
Identical sequences Q1J1N0
gi|94984409|ref|YP_603773.1| 319795.Dgeo_0301 WP_011529449.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]