SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94984410|ref|YP_603774.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94984410|ref|YP_603774.1|
Domain Number 1 Region: 4-203
Classification Level Classification E-value
Superfamily YrdC/RibB 2.75e-82
Family 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB 0.00000176
Further Details:      
 
Domain Number 2 Region: 206-374
Classification Level Classification E-value
Superfamily RibA-like 1.7e-70
Family RibA-like 0.000000908
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94984410|ref|YP_603774.1|
Sequence length 403
Comment GTP cyclohydrolase II [Deinococcus geothermalis DSM 11300]
Sequence
MRLASIPELLAELRAGRPVILVDDERRENEGDLLMPAATATPEWVNFMAREGRGLICVTL
TPERAHTLDLTPMVGMSTDPHGTAFTVSVDHISTSTGISAFDRAATIRALLDPAARPEDF
RRPGHIFPLVARPGGVLRRAGHTEAACDLARLAGFAPVGVICEIMGDSGEMLRLPDLLAF
GERHGLKVGSIEALIAYRMEHDPFMRIAAEAKLPTAYGEFRLVGFEDTLSGAEHVALVMG
EVNEEPLLVRVHSECLTGDAFHSLRCDCGPQRDAALRAIAEEGRGVLVYLRQEGRGIGLL
NKIRAYALQDQGADTVEANLRLGFPADARDFGIGAQILHLLGARRLRVLTNNPRKLHALG
GFGLEVVERVPLHVGQNVHNAAYLATKAEKLGHLALPSSQESA
Download sequence
Identical sequences Q1J1M9
WP_011529450.1.71355 319795.Dgeo_0302 gi|94984410|ref|YP_603774.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]