SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94984418|ref|YP_603782.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94984418|ref|YP_603782.1|
Domain Number 1 Region: 727-782
Classification Level Classification E-value
Superfamily Hypothetical protein PA1324 0.00000706
Family Hypothetical protein PA1324 0.016
Further Details:      
 
Weak hits

Sequence:  gi|94984418|ref|YP_603782.1|
Domain Number - Region: 608-698
Classification Level Classification E-value
Superfamily Bacterial adhesins 0.00596
Family Collagen-binding domain of adhesin 0.084
Further Details:      
 
Domain Number - Region: 127-158
Classification Level Classification E-value
Superfamily Hypothetical protein PA1324 0.0432
Family Hypothetical protein PA1324 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94984418|ref|YP_603782.1|
Sequence length 924
Comment hypothetical protein Dgeo_0310 [Deinococcus geothermalis DSM 11300]
Sequence
MRHVALSLLLPGLLAGVVAVSGLVQASPALTPAGTEIINQATATFDPITPGEPDSAVSNV
VRTTVQAVCAVSITPDGTVANPGQSASLPYGGSAVFSYILVNAGNQTATYPVTARTEEGS
AFTPTTHVYLDANGNGSVDPGEQEVETVTLAPEQSANLLLVVEAASGQGTAYVNLVASCG
GDGQVDSNNVSRMTVAPPPQLGVEKTFTPALIRPGGETTVTVTTRNGGQGEAQAVVLTDP
LEEQLAQGLAFVPGSAQVTAGTLEYTADGVTWQATEPAGVRGVRVRAARLAPDETLTLTF
RMAATPAAENHVIPNVATALANGLTARGSAQVDVRYQPAVALGPSGVPEAPENTPADTQT
KAFAVVGQQVCFDHTLKNTGDVRDDFRVTVTYPQGQARATLLNANGQPLAEPLPLDPGQT
ALIRVCYDLTASGPLEALVTASGSRGTRNATRDLVAGVETGLPELVKTVSPAPTVSLSRG
ETVTYTLSVRNPYTRPLTGVVVSDPLPPHVDFVPGRDTLSDGGTVSGAAGAQVATWNVGT
LAPGETRTFRVTATVSDRAVDGETLNNVFQLVSSELPAPTLSNEVKSPVWNAQLRILKTV
SSPEVTPGDRLTYTLTIRNGSATTDIVDAVVTDTPAAGLVYLPGTATLNGQPLADPEITN
GVLRWQIPRLSAGQEVTLTYQARVGANTQGELTNSAEVVGVGGAARAVASNKSTATVKLR
LLNFAPLNDILGMVYVDRNRNGRFDAGLDTPVERARVILAGGRLVLTDAAGRYHFANVAL
GTQALRLDPNSVPYPPLSVPQDGGLPGTRTVQVNGLTSVDFPLAPLAGEVAALRRTTLTA
GPLRVEKTVTLTPQGYAVTLRLQTTAALEGFELNDPLPPGATLKEGRKSWNGTLPVGETV
LTYTFEFTGSPDAAVTDPNVQWRS
Download sequence
Identical sequences Q1J1M1
WP_011529457.1.71355 gi|94984418|ref|YP_603782.1| 319795.Dgeo_0310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]