SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94984421|ref|YP_603785.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94984421|ref|YP_603785.1|
Domain Number 1 Region: 202-300
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000000000667
Family Multidrug resistance efflux transporter EmrE 0.013
Further Details:      
 
Domain Number 2 Region: 51-157
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000017
Family Multidrug resistance efflux transporter EmrE 0.023
Further Details:      
 
Weak hits

Sequence:  gi|94984421|ref|YP_603785.1|
Domain Number - Region: 156-214
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.0767
Family CAT-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94984421|ref|YP_603785.1|
Sequence length 317
Comment hypothetical protein Dgeo_0313 [Deinococcus geothermalis DSM 11300]
Sequence
MPWPGRLTIPFVSSHTRGLLLLVLVTAIWGSTFAVVKELGTQLPPPVLIAWRFLIAGVVL
WPMLALTRSKEKSRPAPRSRPLWRDGLILGAWLIAGYGTQTVALQTTGANRAAFFTALSV
VLVPVWLTFAQRRPLPMVLWLALPLAVTGLALLSWEGGALVVGDVWALACAVTYAGFIIA
LERAASRHEVLRFTFAQLAAVTLLAWVWAVLAAPAQLWPPAAAWGPLLYLGIAATALTTL
LQTVGQRAVSAAEASLIYALEPVTAGLFSFLLIGERIGARGALGGLLVVAATILSQRAGS
QPHPETPTPQVEGHEVS
Download sequence
Identical sequences Q1J1L8
319795.Dgeo_0313 gi|94984421|ref|YP_603785.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]