SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94984427|ref|YP_603791.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94984427|ref|YP_603791.1|
Domain Number 1 Region: 3-275
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.05e-56
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000244
Further Details:      
 
Domain Number 2 Region: 230-380
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 4.06e-16
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94984427|ref|YP_603791.1|
Sequence length 437
Comment cytochrome b/b6-like protein [Deinococcus geothermalis DSM 11300]
Sequence
MNQWLDERLHLSRLNDKFLRKAFPVHHSFFLGEITLFSLIILILTGILLALAYEPSNSMV
VNSFDPGTAAKPNMIPAAYHSALKINAMPFGDMLRRIHHWTANIMVAAAVVHMMRIYFTG
AFKKPREINWWIGLLLLIFAALTAVTGYALPYDNYAYNTLKVIYGIAASIPWVGEWVAQA
AFAGRFPGDGLIPRVYGYHIMLLPAILLALTGAHLLIMIKQKHTQPQYAKRIAYKKIVGV
PLMTQQTPIMLLLAVLFAAIIVLFSAFIPVHPVEFFGPPSTTPINNIKPDWYLLWVFGAL
AIIPSFEFNFLGGVIGSEFTGAIILPTVIILAMFAVPMLDRSRDNMYYAENPTNHPVRLA
AGIAFLALLIVWSVAGYKPELISANILTTANANTVLWIMTFLVPAVAYFVTLAIVRGIRS
LREADERDRLAHAHADD
Download sequence
Identical sequences Q1J1L2
WP_011529466.1.71355 gi|94984427|ref|YP_603791.1| 319795.Dgeo_0319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]