SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94984509|ref|YP_603873.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94984509|ref|YP_603873.1|
Domain Number 1 Region: 295-491
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.05e-48
Family Ribonuclease PH domain 1-like 0.0000117
Further Details:      
 
Domain Number 2 Region: 9-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.57e-41
Family Ribonuclease PH domain 1-like 0.0000363
Further Details:      
 
Domain Number 3 Region: 454-552
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.89e-28
Family Ribonuclease PH domain 2-like 0.0000813
Further Details:      
 
Domain Number 4 Region: 143-231
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 7.72e-28
Family Ribonuclease PH domain 2-like 0.0023
Further Details:      
 
Domain Number 5 Region: 612-690
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.54e-18
Family Cold shock DNA-binding domain-like 0.00094
Further Details:      
 
Domain Number 6 Region: 556-632
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000091
Family Eukaryotic type KH-domain (KH-domain type I) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94984509|ref|YP_603873.1|
Sequence length 721
Comment polynucleotide phosphorylase [Deinococcus geothermalis DSM 11300]
Sequence
MIAKTYTTMLGGRELSIETGKLAKLASGSVTLRYGDTLLLVTAQAREERSTLDFLPLTVE
FEERHYAVGRIPGSFHRREGRPGEHAILSARITDRQIRPLFPKGYRQETQVIITVLSADQ
QNAPDVLGAIGASAALSLSDIPWNGPTACVRVGMIDGEYVINPTSDQLTRSSLDLVVAGT
RDAVNMVEAGAQGVSEETLVGAIEFAHRELQGVLDLIETMRAEVGREKFNFLVDSDLSTD
LVPELSEAARAAGLRDALLTTKKQERSANLKALRDRLIAERVPDPEAAGAAEQIEALKAA
FAKVEKQELRRLILQEDLRADGRNSKTVRPIWIEARPLPRAHGSAIFTRGETQVLGVTTL
GTERDELLVDNLTGETNDRFLLHYNFPPYSTGEVKRVGGQSRREVGHGNLAKRAIRAVLP
AFDDFPYVIRVVGEVLESNGSSSMATVCAGTLSLMDAGVPIQAPVAGVAMGLVMEGEQYR
ILTDILGLEDALGDMDFKVCGTAEGVTALQMDIKVSGVTPAIMREALAQAREARLHILGK
MAEVLPAPRPELSPTAPRILTLKINPELIGKVIGPGGKQVRELEAMGAQVTIEEDGNIRI
FSADGAAAEAVRQKIEGLTREAKVGEEYEGTVVKTAPFGAFVNLFPGQDGMLHISQMSEN
RVNAVEDVLNVGDRLRVKIANIDDRGKIDLIRPELEGKIAPREPRAARAGGDRGGRPPRR
E
Download sequence
Identical sequences Q1J1D0
319795.Dgeo_0401 gi|94984509|ref|YP_603873.1| WP_011529548.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]