SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94984542|ref|YP_603906.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94984542|ref|YP_603906.1|
Domain Number 1 Region: 2-126,192-294
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 4.19e-68
Family FabD-like 0.00000328
Further Details:      
 
Domain Number 2 Region: 128-191
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.00000000000000366
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94984542|ref|YP_603906.1|
Sequence length 302
Comment malonyl CoA-acyl carrier protein transacylase [Deinococcus geothermalis DSM 11300]
Sequence
MKIAALFPGQGSHAVGMGTDLTATFPQAEAVYAEAEATLPGLRALIEAGPLEDLTLTANQ
QPALVAASVAAYRAWQVQTGLTPTFAAGHSLGEYSALVAAGAVTLADALRLTRRRGELMQ
QAVPVGVGAMSAVMGDPDVVREVCAATPGVVQPANFNAPTQTVISGERAAVDAAAAELKA
RGLKAIPLKVSAPFHCALMQPAQEALAPDLQATAFAPFAFPVYPNVTAEANSDPTALPQL
LARQITGSVRWVETIQALAAAGAEVFVEFGPGTVLTGLVKRILPDAQTVNVGTAEQVRQF
QL
Download sequence
Identical sequences Q1J197
WP_011529580.1.71355 gi|94984542|ref|YP_603906.1| 319795.Dgeo_0434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]