SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94984553|ref|YP_603917.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94984553|ref|YP_603917.1|
Domain Number 1 Region: 65-207
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 3.79e-30
Family Band 7/SPFH domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94984553|ref|YP_603917.1|
Sequence length 538
Comment hypothetical protein Dgeo_0445 [Deinococcus geothermalis DSM 11300]
Sequence
MILTGTLITAALILLGIVLVLVLIQNFLIVVPPNRVLVISGRSRRTEEGDTVGYRVIRGG
RAFRIPVLEKVSWMDLTTIPLDLSIENAYSKGGIPLKIHAVANVKINAQEPQLSNAIERF
LDVPRENVTNIVRDTLEGNLRGVVATLTPEEINEDRLRFAEALIEEAEHDMNNLGIKLDT
LKIQNVSDVGGYLNAIGRRKAAEVLKEARIAEAERNAEATQAEAQALQRSQVAQAISQQA
ILEEQNKLEVRRTELNAIQLSRQNEAAVQSELAKVRATQNFEQEQAALEAALRQKRAEAQ
RQARMVEAQQNAEAAEVEAQARQRATIAQTTAQQAILERENQLRVRKAELEAIAAARENE
AKVSAERARVVAEQQLEQERVILNQKRLEADVVAPARARREAELLAAQAAAAPIIEEGRA
KAEAVRLMAEAFRQAGPEGERAYVLNMLPGIVEQFAAAVQGMQIDKLTVIDSGNGQATKS
AVQTLPANIISMVEQVENATGVNLLSFLQNTGKPQGNGASAVQPSGPGSVKPDASFGG
Download sequence
Identical sequences Q1J186
WP_011529591.1.71355 gi|94984553|ref|YP_603917.1| 319795.Dgeo_0445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]