SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94984568|ref|YP_603932.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94984568|ref|YP_603932.1|
Domain Number 1 Region: 471-884
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.6e-128
Family RNB domain-like 0.00000807
Further Details:      
 
Domain Number 2 Region: 887-965
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.74e-17
Family Cold shock DNA-binding domain-like 0.0063
Further Details:      
 
Domain Number 3 Region: 304-369
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000343
Family Cold shock DNA-binding domain-like 0.021
Further Details:      
 
Domain Number 4 Region: 388-487
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000183
Family Cold shock DNA-binding domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94984568|ref|YP_603932.1|
Sequence length 1182
Comment ribonuclease R [Deinococcus geothermalis DSM 11300]
Sequence
MAEAATLAPPKRTPRQAKASTAAPPPVAEGSAAAEPTATKPRRSRRASPAVKPEDGQTSA
EPAPQPEAPARPSRRGRKAQTAELPQLEPVQREPEAVTAQAPTEERPTRARRGRKSKAEA
APEVLPPVAEPTDPVLLEVPKPTRRGRKSRAAAPEAAPEAAPEPAPVLPDVPLDEVLGGV
EPVEVEESTPDAEATLSVTGKAQTDPPEPVVDTPRVEEVDLPGRHPSAAATPPARLTHPE
EVEEQAEETADPARELVIAQLRKLGRPIHVRDLERTFTRQMLDRLGGWRDLEALLDDLTR
TGEVIRTRRRTYGLPEAMSLVRGRFQASPTGFGFVIPDAGGEDFYVAPEDTLEAWNGDTV
LVRMEGRGDSGRSPGPRRGQRGDGSPRASVARIVQRAYRHLVGTLEFSKGHPILKADDPR
ARHRILLLPEGLEGLASGARVVAELYWPEQTGEDEVFGQVIRVLGEQDDPATETEAVIVK
YGLRGEFPADVLEEANAIPTRIPPESLVGRLDLREFNIFTVDGRDAKDFDDAIHIQPTPE
GTFVVGVHIADVSHYVREGTPLDQEAYARATSVYLPGRVLPMLPEHLSNGVCSLVPFEDR
LTVTALIELSAEGDILDVKLAPSVINSKARLTYDEVQAYSEATSTLPEHARHLEGDLHLL
LKITSKLRQKRLREGSLDFKLREVKVDVGPDGRMELIPIHEETARGMIEDLMLLANKVVA
HYLIERGIPTLFRIHEEPTLQRFQEATAAIARLGLAFPGGEPTPQAYQAVLKAVRGTPRE
SVVNTLLLRSLQQAKYAGENLGHFGLAFAEYLHFTSPIRRYPDLFVHRVLKAVLSGDLKA
GSRAVAELRSQLPAMGDHTSERERKAAEAERDLTKYYQAKWAQEHLGERFSGNVTGVVSS
GLFVALDNGVEGKLHISNLDDDYYIYLEDAQMLRGRSGGRTFRLGDPITVTISQVNPLAR
QIDFTQENDMDSNDNTARPRARRREDREAEKRQKLQSVNPAPPRKFTLDDPQPAVPSAPP
RQSGQGRGGRGQGQREGSQREANPSGGRAPLRQSGSFKRRVITLERPRNEHLRPVNITVQ
RMYFGDWTVDNLPPDDGQHGGRGFDRSDRGGRGPGFSRGGNDRGAVRDLNGRQGGSRQVR
PSAPPPQVTSQADAAQPGNDTDGKRRRRRRGRRGGNGNSSQG
Download sequence
Identical sequences Q1J171
319795.Dgeo_0460 WP_011529606.1.71355 gi|94984568|ref|YP_603932.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]