SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94984592|ref|YP_603956.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94984592|ref|YP_603956.1|
Domain Number 1 Region: 95-328
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 3.53e-35
Family MurCDEF 0.001
Further Details:      
 
Domain Number 2 Region: 315-459
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 1.01e-26
Family MurCDEF C-terminal domain 0.00062
Further Details:      
 
Domain Number 3 Region: 38-120
Classification Level Classification E-value
Superfamily MurCD N-terminal domain 0.000000306
Family MurCD N-terminal domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94984592|ref|YP_603956.1|
Sequence length 466
Comment UDP-N-acetylmuramoylalanine--D-glutamate ligase [Deinococcus geothermalis DSM 11300]
Sequence
MLRRGGSASTLRRSRTSNLLLHSFPYRWDVTECAGAREKILIYGLGRSGRGVARFLAREG
VRAEWHDAHPTAEDEALMQELGFLRGDPGGTYRTVVAAPGVPIDHADLLALSAGGAEIIG
EVTLAARLRPHLPLVGVTGTAGKGGTTVLIAHLLRAQGLSALEGGNIDPPLLDVVDQAEV
AVVELSSFQLERVPGLRLPVAVITNLGVDHLDRHRTVEAYHAAKLNITAGQEAEDVLVVP
AGLEVRTRAQLRPFQPERLSLADGRELLPVADLPEGIHPANAAAAVLAAEALLTRLGRPV
EPERLAAGLRSARPVAGRFETVARIGNVRFIEDSIATRTLAVEAALTRAVPPIAWLVGGR
DKGADLVPLRAAAQGRVRRVIAFGEDGEKLARALGLPFETVPGTDGDTVMQAATRAGLEA
LGGPGGAGTVLLAPIGTSFDLFRDYKARGASFTRAARALVAGEVRA
Download sequence
Identical sequences Q1J147
gi|94984592|ref|YP_603956.1| 319795.Dgeo_0485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]