SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94984732|ref|YP_604096.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94984732|ref|YP_604096.1|
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.5e-17
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94984732|ref|YP_604096.1|
Sequence length 218
Comment glycolate oxidase subunit GlcE [Deinococcus geothermalis DSM 11300]
Sequence
MPILDLSPGDQTVTVSGDTPLLEVYAALPAGLFPPFPPVELPGGVGGLVARGGFAQTFFF
GAEVLGVTFRAPSGRVIRAGGRTVKNVQGYDLTRPFVGSFGRLGEALDVTLRLRPGPRAQ
HVAASGSLEALGPLSARFAWQDGEDVHLLHFGHAREVERALAVLPGAREVEEPLDLTARF
PGGIGVGEGALRDRRFGWVNGGAAPPVPPLFARLAASL
Download sequence
Identical sequences Q1J0Q7
WP_011529768.1.71355 319795.Dgeo_0625 gi|94984732|ref|YP_604096.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]