SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94984803|ref|YP_604167.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94984803|ref|YP_604167.1|
Domain Number 1 Region: 22-332
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 1.32e-103
Family Adenylation domain of NAD+-dependent DNA ligase 0.0000000998
Further Details:      
 
Domain Number 2 Region: 420-597
Classification Level Classification E-value
Superfamily RuvA domain 2-like 8.15e-59
Family NAD+-dependent DNA ligase, domain 3 0.0000142
Further Details:      
 
Domain Number 3 Region: 334-416
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.63e-25
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.0004
Further Details:      
 
Domain Number 4 Region: 606-680
Classification Level Classification E-value
Superfamily BRCT domain 9.91e-19
Family DNA ligase 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94984803|ref|YP_604167.1|
Sequence length 684
Comment NAD-dependent DNA ligase [Deinococcus geothermalis DSM 11300]
Sequence
MRGRCYASTMSQPASQVSATLEHYLALRAEIERHNRAYYELDAPEIPDDEYDRLVRELRA
LEAAHPEWVAENSPAQTVGGAPSSAFLPVEHPTPMTSLDNVFSDEELAEWQEKLARALNL
PPDHDGFTYTGELKIDGLSVNLYYADGVLQWAATRGNGRVGEMVTEQVLTIPGIPRALPG
LTGELEVRGEVYLSRADFAAFNARAEELGLPLLKNPRNGAAGALRQKDPEVTRTRHLKAL
FYSLGKHDGVPVRTQGEVLAWLAEQGFPTSRYSETFTGLQAAADYHRRMTAQRAQFEFDA
DGTVLKLDSLALQAEAGSTSRAPRWAVAYKFPVEEVETVLESITVNVGRTGKLAPLAHLS
PRLIEGSTVSKATLHNEDYIRDLDLRIGDTVVVRKSGGVIPQIMRVVLEKRPPDAAPYRF
PTHCPECGHEVVRAEGDANTYCPNPACPAQQFERLRYFVSRGAMDVRGVGEKLIEQLLAT
GLVHDAADLYQLTAEQLASLERSGEKKAANILAQLEASKTRPLWRLINALGINHVGERNA
QALARAFGTLDALLAATPESIEAVPGLGRTIAQSVSAALADPSMQDLIRRLRERGLKPVE
ETAPRGDALAGLSFVLTGTLSRPRDEIKARLESAGARVTGSVTKKTSYLIAGEEAGSKLD
RARELGIPVLDEAGLGALLEERGV
Download sequence
Identical sequences Q1J0I6
319795.Dgeo_0696 gi|94984803|ref|YP_604167.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]