SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94984819|ref|YP_604183.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94984819|ref|YP_604183.1|
Domain Number 1 Region: 68-346
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 1.96e-25
Family YVTN repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94984819|ref|YP_604183.1|
Sequence length 348
Comment hypothetical protein Dgeo_0712 [Deinococcus geothermalis DSM 11300]
Sequence
MKPLSSAAPCRAARLALSLLALAALAPTSPAQTAPGETRVPPDPLVLVGVAPRVLPGPPG
TLAAGIAAVRGRYSAHVRLLDPTTGEVRREVFLPPEVQLDVPPALSADGRWLAVVLTPDP
VTHVGRVGILSTTPTTPPGFQKVLSAGGLNGTLALAFGPDGTHLATSNRSGYAQLWEWPT
GRRVTTVTSETGYEPSRLEFSPDGRLFAPIFRGQTRTRIFDTQTGALRTTLSGVGYGTFT
PDSRGFLASRGRLINLADGKELPAPAYLAGTSGVLGFSADGTRVLVRRTGVDVQGREWLE
LREVATGRTLGALTRVWDGWPEALSPDGTTLIGGDGEGGIRLLPLAPR
Download sequence
Identical sequences Q1J0H0
gi|94984819|ref|YP_604183.1| 319795.Dgeo_0712 WP_011529855.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]