SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94984831|ref|YP_604195.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94984831|ref|YP_604195.1|
Domain Number 1 Region: 10-358
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.18e-95
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000000301
Further Details:      
 
Domain Number 2 Region: 360-516
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 1e-33
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0000711
Further Details:      
 
Domain Number 3 Region: 565-669
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.45e-30
Family Myf domain 0.0000607
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94984831|ref|YP_604195.1|
Sequence length 670
Comment methionyl-tRNA synthetase [Deinococcus geothermalis DSM 11300]
Sequence
MTRQPESTQNEFFITTAIDYANGAPHIGHVYEKILADALARYHRLAGYDVTFVTGTDEHG
EKIAKAAAKAGQTPQTFVDDLSLRAFKGLWDRLEISYDDFIRTTEGRHKRFVAEILQRVY
DAGDIYFAEYEGLYSVGAERYVTEKELVEGPDGVRRYPGDKDPPELRREANYFFRMEKYQ
DWLRAHIEQNPDFIQPAGYRNEVLEMLREPIGDLSISRPKSRVPWGIELPWDPDHVTYVW
FDALLNYVSAPVSRGLGEETIGKAWHVIGKDILKPHAVFWPTMLRAAGLPIYRKLVVHSH
ILAEDGRKMGKSLGNAIDPEQLVREYPVDAIRYTLLREATLSADSPYGEGILVSRLNSDL
ANDLGNLLSRTVSMIQKYRGGVLPQALEVGEREREVEAKALALPSEVMTLVRDLKVNMAI
ETAMNFVRDLNRYIAESQPWNLAKSEETARRLDTVLYTAAEGLRVASVALEAVIPGKARE
LRAQLGLGGQSYALRGAWGLTPAGTRVVGGPVLFPKPELPKPEAPEAAATPPTPRKEKTT
VTPPRNAQAPAPTPTATPAAPEALISIDDFARVDLRIAEVVAAEAVEKADKLLKLTVKMG
DETRTVVSGIRKWFAPEDLVGRKVILVANLKPARLRGIESQGMILAAEDDAGNLDLVGTR
LDLPSGTKVR
Download sequence
Identical sequences Q1J0F8
gi|94984831|ref|YP_604195.1| 319795.Dgeo_0724 WP_011529867.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]