SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94984833|ref|YP_604197.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94984833|ref|YP_604197.1|
Domain Number 1 Region: 65-133
Classification Level Classification E-value
Superfamily RuvA domain 2-like 1.56e-18
Family DNA helicase RuvA subunit, middle domain 0.0009
Further Details:      
 
Domain Number 2 Region: 1-62
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000742
Family DNA helicase RuvA subunit, N-terminal domain 0.0022
Further Details:      
 
Domain Number 3 Region: 150-197
Classification Level Classification E-value
Superfamily DNA helicase RuvA subunit, C-terminal domain 0.000000000785
Family DNA helicase RuvA subunit, C-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94984833|ref|YP_604197.1|
Sequence length 198
Comment Holliday junction DNA helicase RuvA [Deinococcus geothermalis DSM 11300]
Sequence
MIAYLSGAVREVREASAVIVAGGVGYEVFCPASTLGRLVPGQPAELNIRHVVREDAQLLF
GFLDTDSLRLFDLLIGVSGVGPKLALSLLSALPVTAVAQGLLSGDVKLLSSVSGVGKKTA
ERLVLELQNKVPEHLAAGAPVSAGKAALTSTAGRDAIEALLALGFREPQVRSVVAELLAA
DPEQSADALIRKGLGKLR
Download sequence
Identical sequences Q1J0F6
WP_011529869.1.71355 319795.Dgeo_0726 gi|94984833|ref|YP_604197.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]