SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94984958|ref|YP_604322.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94984958|ref|YP_604322.1|
Domain Number 1 Region: 37-305
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 3.41e-66
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94984958|ref|YP_604322.1|
Sequence length 310
Comment proline dehydrogenase [Deinococcus geothermalis DSM 11300]
Sequence
MIDQLYRKAVLTVSGQKFVENLVRARGWGVAQRFVAGEDAASALQAVRELEGDGILGNLD
LLGEFIDSPEQCNAFAERVLSLLDQANAAGIRPYVSIKLSSVGQGQTVNGEDLGLSNARR
IVGRAKGYGGFVCLDMEDHTRVDLTLAQFRTLVNEFGNAFVGTVLQSYLYRSEADLAALG
DLRPNLRIVKGAYLEPATVAMPDKADVDASYRRLVYAQMKAGHYVNVATHDERIIEDVKH
FVLAHGISKDAFEFQMLYGIRRDLQKELAQQGYRVRAYIPYGRDWYPYFARRIAETPRNA
LFVLRGMLKG
Download sequence
Identical sequences Q1J031
WP_011529991.1.71355 gi|94984958|ref|YP_604322.1| 319795.Dgeo_0851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]