SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94984962|ref|YP_604326.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94984962|ref|YP_604326.1|
Domain Number 1 Region: 85-227
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.05e-32
Family RecO C-terminal domain-like 0.000000595
Further Details:      
 
Domain Number 2 Region: 6-75
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000103
Family RecO N-terminal domain-like 0.0000703
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94984962|ref|YP_604326.1|
Sequence length 243
Comment DNA repair protein RecO [Deinococcus geothermalis DSM 11300]
Sequence
MRSRSANRSGIVIRRRVTPAGDIIVTLLTPQGKVKAIARGGVRGALSSRLNLFHHVAIQL
YQTPQADLATVQQTVLEGALPKLAEPERYAFAHLMAELADALFQEGEFSEQAFELFAGAL
RGISHQPDPEWVALVMSYKLLGLAGFVPQTGRCARCGAAAPTHPDPLGGQLLCGACASLP
AYPPEGLDFLRNVVRRSVRANMDRPVPEEQRPALWRALERFVTVQVGNVQSWRQLVPAGA
VSV
Download sequence
Identical sequences Q1J027
gi|94984962|ref|YP_604326.1| WP_011529995.1.71355 319795.Dgeo_0855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]