SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94984971|ref|YP_604335.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94984971|ref|YP_604335.1|
Domain Number 1 Region: 3-205
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.94e-54
Family G proteins 0.00022
Further Details:      
 
Domain Number 2 Region: 150-297
Classification Level Classification E-value
Superfamily Translation proteins 5.5e-32
Family Elongation factors 0.0086
Further Details:      
 
Domain Number 3 Region: 395-508
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.49e-31
Family EF-G/eEF-2 domains III and V 0.0018
Further Details:      
 
Domain Number 4 Region: 300-384
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.00000000000000245
Family EF-G/eEF-2 domains III and V 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94984971|ref|YP_604335.1|
Sequence length 593
Comment GTP-binding protein TypA [Deinococcus geothermalis DSM 11300]
Sequence
MEYRNIAIIAHVDHGKTTLVDGMLKQTLELKHGEEIAERAMDSNDLERERGITILAKNTA
VEYKGVKINIVDTPGHADFGGEVERVLGMVDGALVLVDAAEGPMPQTRFVLRKAIELGLK
PIVVVNKIDRQDARPEEVVNLTFDLMAELGANEDQLDFPILYAVAREGKAFRDLENPQPD
MHELFDMVLEHIPAPQVDLDAPFQMLVTNLDYNEYLGRIVLGRVQRGRVKKGEFVNLIHK
DGTMTKTRVIQPFTHLGLRRIEVDEVSAGDIVALAGIEDAQIGETVADLADPEALPIITV
DEPTVSMIFQPNTSPFAGKEGKYVTSRHLNDRLKREVMTNVSLKVEEIRPDEFKVSGRGE
LHLSILLETMRREGYEVQVGAPQVITREIDGVKHEPIEHLVIDVPEQFASSVIGVLGARK
GQMVNMEPQGSRVRVEFKIPSRALFGFRTQFLSMTQGEGIMSHIFDGYAPWAGELKTRQN
GSLVSMEDGVAFAYSIFKLQDRGTFFIEPGQDVYVGMIVGENAREQDMNVNVCKNKKLTN
IRSAGADEALTLTPPRRLSLEDALEYIADDELVELTPQSIRLRKKILNPSFRK
Download sequence
Identical sequences Q1J018
WP_011530004.1.71355 319795.Dgeo_0864 gi|94984971|ref|YP_604335.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]