SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985006|ref|YP_604370.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985006|ref|YP_604370.1|
Domain Number 1 Region: 310-526
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.72e-43
Family ABC transporter ATPase domain-like 0.0000654
Further Details:      
 
Domain Number 2 Region: 50-305
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 6.67e-29
Family DNA repair protein MutS, domain III 0.0099
Further Details:      
 
Domain Number 3 Region: 711-787
Classification Level Classification E-value
Superfamily SMR domain-like 0.0000000327
Family Smr domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94985006|ref|YP_604370.1|
Sequence length 789
Comment MutS2 family protein [Deinococcus geothermalis DSM 11300]
Sequence
MHSAFPTGPKPHSARSVGGSVVILLPEMPFAPRALTALDFPRIRDALAERSATPLGVERA
RALLPSEDGDRIRRELDEVEDALFGVSLALGGIQDIRELYTRALEGRVLSGQELLTAAYS
LDGAMSVKRAINANSRGPLKEVALSLGDHSELVRRVLSALDRDGAVRDDASHKLRDLRRR
IEPLRSRIRERLAATLDRWADVLQEHIVTIRRDRYVLPVQASRVGQVQGIIVDASATGQT
YFVEPAAVTPLNNELTRLILDEEAEVRRILSELSGLFAADADVPMTLATVAELDLIAAKA
RLARDWRLNRPEPASDHTYDLREARHPLIEHPVPNDIELGQTKLLLITGPNMGGKTATLK
TLGLAVLMHQCGMYVAAARARLPVVRDVLVDIGDEQSIEASLSTFASHLKHLRFVLRHAG
PDTLVLIDELGSGTDPEEGAALAQALIETLLAQDARGIITSHLSPLKLFALETPGLKNAS
MSFDLATLSPTYHLQVGQPGRSYALAIARRMGLPPEVLDRAAQLLGPDAGLMERMLEGLE
RERAELATQLNTATTARREAEAELARARQERETLEQRRNEMLAEAAQKAESLYADAIERV
RTLRARAQEESARPRVMQELRELRTAAQKARPAPPPSREERGDPLRVGSQVDVPAYGATG
QVLEVRGDDLVVQLGVMKVGVKRRDVRVKPEPKVKAPRPSFAGTSPNTFQNELQLRGLGV
EEAVEELRHAIAEAHALKETPLRVVHGKGQGVLRRLLRDYLKTDKRVESFHDAEANQGGH
GVTIVNVKV
Download sequence
Identical sequences Q1IZY3
319795.Dgeo_0899 gi|94985006|ref|YP_604370.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]