SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985010|ref|YP_604374.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985010|ref|YP_604374.1|
Domain Number 1 Region: 158-496
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.33e-109
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000294
Further Details:      
 
Domain Number 2 Region: 13-150
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.1e-34
Family Anticodon-binding domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94985010|ref|YP_604374.1|
Sequence length 512
Comment lysyl-tRNA synthetase [Deinococcus geothermalis DSM 11300]
Sequence
MSADHIPDSRRAGLHEQTISRLNNQDALRAAGFETHPYSYPQTHHSRDVLAAHPDAEPGQ
EWPEETYALAGRVTLLRHMGKAAFADLTDEQGRIQLHFSKQDTEHFNATKKIDLGDIIGV
TGFPFVTKTGQLTLRVKSWQPLVKSLHPLPSKFHGLQDEELRARRRYLDLMVTAGVRQKF
QARSRIIRYLRNELDRRGFMEVEGPTLQVTAGGAEARPFMTHHNALSHDFKLRISLELYL
KRLLVGGFERIYEIGRVYRNEGIDRTHNPEFTMLELYWAYVDYTEIARLVEELLSGLAQE
LHGSYTFEYQGRTLDFTPPFARVDYVGALREHVPGLDFDPLDLDRLRQFSDARFPQWKDV
PSYKLLDKLFGEFVEPLLTNPTFVMDHPAVISPLAKRHRTRPGLTERFEVFCSGFELANA
FSELNDAFDQRARFEAQSQRREAGDEEAHAQDEDFLLALEYGMPPAGGLGIGIDRLVMLL
TDSDSIRDVLLFPLLRPEGQSQAAEERAEATR
Download sequence
Identical sequences Q1IZX9
gi|94985010|ref|YP_604374.1| WP_011530043.1.71355 319795.Dgeo_0903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]