SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94985164|ref|YP_604528.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985164|ref|YP_604528.1|
Domain Number 1 Region: 1-249
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.45e-65
Family Phosphate binding protein-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94985164|ref|YP_604528.1|
Sequence length 252
Comment extracellular solute-binding protein [Deinococcus geothermalis DSM 11300]
Sequence
MIKKALLTLTALSLLTSAAQARTWDEIKQSGVIKIATEGAFPPFNLMKGNQLTGFEVDLA
NALAKQLGLKPQWVTQPFDNLLIGLNQDRYDFVIASHGITPERQKAVDFANPHYCTGGAI
VTRSGGPMTAAALKGKSVAVQVGTTYLQNVSKVPGVGAVKTFPKDTDAQAALLAGRVDAW
VGDKFTGLDVVKAQKGKLVQGDLLFKERIGMAVKKGNTTLLKELNSALATLMNNGTYAKI
SHQYFGQDIRCR
Download sequence
Identical sequences Q1IZH5
gi|94985164|ref|YP_604528.1| 319795.Dgeo_1060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]