SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985171|ref|YP_604535.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|94985171|ref|YP_604535.1|
Domain Number - Region: 65-123
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00456
Family PDI-like 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94985171|ref|YP_604535.1|
Sequence length 133
Comment penicillin-binding protein 1B McrB [Deinococcus geothermalis DSM 11300]
Sequence
MMPEMKRAPLLTLLLALGTPADARVRLGDPLPTHPWTSPGREVIVVYSHDCGDLGDLWGA
VLAAGLPVRAVNAEDVPAPAPKGINVWRGPEATAFARALRVGAYPTVLLVQGGRVLNAWE
GDFSGDLGIKPPA
Download sequence
Identical sequences Q1IZG8
319795.Dgeo_1067 WP_011530203.1.71355 gi|94985171|ref|YP_604535.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]