SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985191|ref|YP_604555.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985191|ref|YP_604555.1|
Domain Number 1 Region: 125-346
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 1.57e-80
Family Creatinase/aminopeptidase 0.000000882
Further Details:      
 
Domain Number 2 Region: 7-125
Classification Level Classification E-value
Superfamily Creatinase/prolidase N-terminal domain 5.41e-24
Family Creatinase/prolidase N-terminal domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94985191|ref|YP_604555.1|
Sequence length 348
Comment peptidase M24 [Deinococcus geothermalis DSM 11300]
Sequence
MASLRELRTALKAAGVDALWVSDPANVRALSGFSSGKDGKVLVTGDSATLYTDARYTVQA
QEESRLPQVIARPPETYQDAAARVQGQRVGFEAEHLTVAGWEALREHWDATLVPTRGLVE
GVRRVKAPEEVQAIRAAQAIADRVFEAVRPTIQAGVRELDVALALELGLRRAGAEVGFDV
IVASGPRGAMPHGVASARVIEDGDLVTIDFGARVGGYHSDMTRTVAVGQPSAELRRIYRA
VLEAETAAVAAIRPGAQAGELDALARGILERHGLGEAFAHSLGHGVGLSIHEGPSLRAGS
EDVLEPGMVVTVEPGAYLPGLGGVRIEDLVLVTESGHEVLSRAPKEQL
Download sequence
Identical sequences Q1IZE8
319795.Dgeo_1087 gi|94985191|ref|YP_604555.1| WP_011530223.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]