SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985206|ref|YP_604570.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985206|ref|YP_604570.1|
Domain Number 1 Region: 96-377
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.13e-66
Family RecA protein-like (ATPase-domain) 0.000000168
Further Details:      
 
Domain Number 2 Region: 57-131
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.77e-17
Family Cold shock DNA-binding domain-like 0.0017
Further Details:      
 
Domain Number 3 Region: 11-54
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000002
Family Rho termination factor, N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94985206|ref|YP_604570.1|
Sequence length 425
Comment transcription termination factor Rho [Deinococcus geothermalis DSM 11300]
Sequence
MTEPQTVPLPFHELQQKILPELHLIAAQNGIENYRKLKKEALALAILERQAEAEGQVLAR
GFLDISPDGYGFLQSDLLDPASRSVLVTAGVIKQFHLRTGDEVIGRARRPRENERYGTLV
QVEAVNGLDPETARKRPRFDDLTPTFPDRQLVLEDPQMDDGLSLRVVDLLVPIGRGQRAL
IVAPPKAGKTTLLKKIANSIVKNYPDVTVMVLLVDERPEEVTDFRESVQGAQVIASTFDE
PPQHHVRVAEFVHERARRIVEEGGHVVILLDSITRLARANNLVTPPTGRTLSGGLDSNAL
HWPKRFLGAARNIREGGSLTILATALVETGSRMDDVIFEEFKGTGNAELVLSRRLEERRI
FPALDILKSGTRREELLLQPEVLKKMWLLRKVISDMDPADAMEMLLSRMGKTRNNVEFLQ
SLAGG
Download sequence
Identical sequences Q1IZD3
gi|94985206|ref|YP_604570.1| WP_011530238.1.71355 319795.Dgeo_1103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]