SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985224|ref|YP_604588.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985224|ref|YP_604588.1|
Domain Number 1 Region: 5-326
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.3e-82
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000096
Further Details:      
 
Domain Number 2 Region: 341-428
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.00000000000000245
Family Anticodon-binding domain of Class II aaRS 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94985224|ref|YP_604588.1|
Sequence length 431
Comment histidyl-tRNA synthetase [Deinococcus geothermalis DSM 11300]
Sequence
MALQRPKGTQDHLPDGSPKLSRDVQASAFAYVQDTARRVLERAGAQFIATPLFEEAELVR
RGVGGSTDIVRKEMFTVYYFGDHGGYVLRPEGTAGIVRAYLQNGLKQLPAPLKLWTHGPM
FRAENVQKGRLRQFHQVDYEALGSADPLVDAEAIWLMWEVVRELGLTGVRVKLGSIGDPA
DREAYNAYLRDCFTPHAARLSDDSRDRLTRNPMRILDSKSTGDQALIGELQVKPMLDFLG
EAASSHFAAVQAYLRAWNVPFDIDPAIVRGLDYYRRTAWELHHQGVGAKSALGGGGRYDG
LSTQLGGPEVPGIGWAFGIERLLLALEAEGVTFPEESGPLLFLAALDEEHVARAAGLALE
GRRVARVEFAYRALKPANAFKEADRRRARYAGLLGSDEAERGVLTIKHLASGEQQEVPLA
ALNTFLAERAR
Download sequence
Identical sequences Q1IZB5
gi|94985224|ref|YP_604588.1| 319795.Dgeo_1121 WP_011530256.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]