SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985227|ref|YP_604591.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985227|ref|YP_604591.1|
Domain Number 1 Region: 517-608
Classification Level Classification E-value
Superfamily RuvA domain 2-like 3.08e-19
Family Excinuclease UvrC C-terminal domain 0.065
Further Details:      
 
Domain Number 2 Region: 12-91
Classification Level Classification E-value
Superfamily GIY-YIG endonuclease 6.41e-18
Family GIY-YIG endonuclease 0.0085
Further Details:      
 
Domain Number 3 Region: 181-230
Classification Level Classification E-value
Superfamily C-terminal UvrC-binding domain of UvrB 0.0000000000418
Family C-terminal UvrC-binding domain of UvrB 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94985227|ref|YP_604591.1|
Sequence length 616
Comment excinuclease ABC subunit C [Deinococcus geothermalis DSM 11300]
Sequence
MHFDDLPVLPASPGVYIFRRGGTPIYIGKAVNLRSRVAQHFKAGGKSGKFTALADSLDFI
TTRNEVEALILEANLIKQHRPHYNVLLKDDKHYPFLKLTNEAFPMLVVTRRVLKDGASYY
GPYPDASAVRRVKHLIDTMFPLRKNSGLPMQKKPRPCLNYHMGRCLGPCVDAADPQAYAQ
VVEDVKALLEGRAAPVIARLKADMQAAARAQDFEQAARLRDRVQAVEKLFGTEQHAYVSE
ETDLDFLGVAQAGEYAMVQLFRLRGGRVVGRDKRFLVGAEGGADVGEVLGAFVQDYYTQA
THVPPLILLPAEFEDAPVWSAFLSERAGRRVEMRTPKRGDKAELVEMAQRNAAAGLESEL
ALLERRGDHPGLDALREVLALPDRPWRIEGYDNSNLFGSNIVSGMVVFEGGRARRSEHRR
FKVRGLDHPDDYAAMHQTITRRLTGSLADKLPLPDLILIDGGRGQVHAALDALRAADVRV
PLVGLAKREERIILPGRFGAQWWLETGTEVGVGGELLLPHTHPALRVLIGVRDEVHHYAV
SYHRTLRGEQMLRSVFDDLPGIGQKRRDALLEHFTSLEDLAAAPVERIAAVPGMNLRAAQ
SVKKFLAERTANGTPT
Download sequence
Identical sequences Q1IZB2
gi|94985227|ref|YP_604591.1| 319795.Dgeo_1124 WP_011530259.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]