SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985238|ref|YP_604602.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985238|ref|YP_604602.1|
Domain Number 1 Region: 101-448
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.78e-85
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000807
Further Details:      
 
Domain Number 2 Region: 11-97
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.13e-19
Family Anticodon-binding domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94985238|ref|YP_604602.1|
Sequence length 449
Comment asparaginyl-tRNA synthetase [Deinococcus geothermalis DSM 11300]
Sequence
MTVIPNVSIDALKNHVGETVRVNAWLTDKSGKGKLQFLKLRDGSGFVQATVFKGDVPEEV
FEAARRLSQEQAVRVTGEVRADERAPGGVELAVRDLVPFAANQAEYPITPKEHGIEFLLD
HRHLWLRHRRPWAILRVRDCVERAIVEFFHQEGFIRFDAPFFTPNAAEGTTELFEIDLFG
EDKAYLSQTGQLHAEAGALAFGKVYTFGPTFRAEKSKTRRHLLEFWMVEPEVAPATHQDN
MDLQERLVSFLVRRVLEECAAELAVLGRDVAKLQPAAEGNYPRVTYTEALDIIRRHIAEG
DLPPNVQPDVQPVEWGDDLGAPHETILGFHFDRPVIVERYPAAIKAFYMQPDPADPRLAL
CDDMIAPEGYGEIIGGSERIHDYTLLKARIEGEGLPLSAFDWYLDLRRFGSVPHAGFGMG
LERVIAWITGIDHIREAIPFPRMLTRMVP
Download sequence
Identical sequences Q1IZA1
WP_011530270.1.71355 gi|94985238|ref|YP_604602.1| 319795.Dgeo_1136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]