SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985241|ref|YP_604605.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985241|ref|YP_604605.1|
Domain Number 1 Region: 271-531
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.87e-54
Family Tandem AAA-ATPase domain 0.00000163
Further Details:      
 
Domain Number 2 Region: 530-731
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.89e-39
Family Tandem AAA-ATPase domain 0.00000886
Further Details:      
 
Domain Number 3 Region: 94-266
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.85e-39
Family RecG "wedge" domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94985241|ref|YP_604605.1|
Sequence length 776
Comment ATP-dependent DNA helicase RecG [Deinococcus geothermalis DSM 11300]
Sequence
MATVAEMREKLRRPLAAELAAGCADRVVAGGVERLLASPLAGPFPQVREALRGYAELDAA
GRAAALHRALALLDGAVQKTVPVPRQAVPVPAPGERLPLDTPVTRLDTGPGGARKLQSLG
LHTLRDVLHAYPHRHEDRRALPDLAAVEEGQKVTVEGRVVTKARRKPKPNLLIVEATLET
PAGGRVRASWFNQPWVERQLREGARLVLTGRVKRFGRTVQLGVEHLETLEDARESLSTGR
IVGVYDSKEGISQEFLRRVAFRALQAAPLDDYLPAHWRRERGLTDLADALWGIHFPAGEA
QLKRALHRLRFDEYLFLELRMLLQGEDAVLLGKRFQATGEDIERFEAALPFRLTGAQRRV
LLEIVADMRSERQMARLVQGDVGSGKTAVAAAALYLAVRDGYQGALMAPTEILARQHYAN
LLGYLAKLDVRVGLLIGAMTPKAKLEMQTRIAEGDVDVVVGTQALIQENVRFNNLGLAVV
DEEHRFGVMQRRRLLTGRPDVLVMSATPIPRSLALTAYGDLELSVIDELPPGRTPVETKL
IQDTHRQQAYGFVMRQIREGRQAYVVTALIEQNENLELLAATQLADDLRVLLPEARIELL
HGRMTAAEKDLVMERFRAREFDVLVSTTVIEVGVDVPNATVMVIENAERFGLSQLHQLRG
RVGRGSAQSYCILIAGEHSNKTRQRLKIIEGSTDGFVIAEADLKLRGPGELRGTRQSGIP
DLRLGDLASDIEIIEQARALAKHILAHDPKLEHPRLRGLRQELQSRSQSVAFREVI
Download sequence
Identical sequences Q1IZ98
gi|94985241|ref|YP_604605.1| 319795.Dgeo_1139 WP_011530273.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]