SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985299|ref|YP_604663.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985299|ref|YP_604663.1|
Domain Number 1 Region: 185-285
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000000471
Family Multidrug resistance efflux transporter EmrE 0.017
Further Details:      
 
Weak hits

Sequence:  gi|94985299|ref|YP_604663.1|
Domain Number - Region: 47-139
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00183
Family Multidrug resistance efflux transporter EmrE 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94985299|ref|YP_604663.1|
Sequence length 295
Comment hypothetical protein Dgeo_1197 [Deinococcus geothermalis DSM 11300]
Sequence
MPPVRRALSSLPPIPALLLSMLSIQGGAAFAKTLFPTLGALGTTALRVTLAAALLSLVFR
PRLGALTTSAWRAVLPYGLALGLMNLTFYLSLTRLPLGLAVTLEFVGPLVLSLALSRRLQ
DLLWVGLAALGIVLIAPRGGGEGHLDLLGAGLALTAGALWAGYILAGGAVGRRVPGVTGV
VAGMMVAAVVTLPFGFATAGTALLAPSALLAGLAVAILSSALPYSLEMVALRAIPARVFG
VLMSVEPAIAALSGLLFLHERLSALQWLAMLCVIAASVGISLSGERQVVEAEPAN
Download sequence
Identical sequences Q1IZ40
gi|94985299|ref|YP_604663.1| WP_011530331.1.71355 319795.Dgeo_1197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]