SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985303|ref|YP_604667.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985303|ref|YP_604667.1|
Domain Number 1 Region: 93-247
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.49e-20
Family AlaX-like 0.028
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Translation proteins 0.0000000000000812
Family AlaX-M N-terminal domain-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94985303|ref|YP_604667.1|
Sequence length 399
Comment threonyl/alanyl tRNA synthetase [Deinococcus geothermalis DSM 11300]
Sequence
MTRPLYDTSPTRLTFTATVTDRRDGAVALDASAFYPEGGGQNGDVGVLRWRGGEARVTDT
RKDKSSGVIWHEGEGELPPVGASIRGEVDPVCRWRNMARHSAEHLLAQAFHRVNPAFAVA
AVSLRNAESTIDLTGDPGEADVRAAERLLRETLARTELTLETLTVPEEELYRYPLRREAK
VRGDVRLVIFRDAEGIPFDVSACGGTHVPCASMVAPVVVLRTERIRGGLTRVFFMAGEEA
SAYLADVYRDARALAQSFSASVSDLPGRVAALATERDMLKAEGTALRARLARLLADAAPL
ETVAGVPLRLLNLEDPNLLSDALAATPKGEVRVALASGGRCGVGSGREDVSAGKLLEAAL
RLTGGKGGGRPALAQGRTAAPEQFGEAVREVLQTTRAPA
Download sequence
Identical sequences Q1IZ36
WP_011530335.1.71355 319795.Dgeo_1201 gi|94985303|ref|YP_604667.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]