SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94985328|ref|YP_604692.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985328|ref|YP_604692.1|
Domain Number 1 Region: 2-84
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.57e-21
Family Tandem AAA-ATPase domain 0.00059
Further Details:      
 
Domain Number 2 Region: 113-191
Classification Level Classification E-value
Superfamily HRDC-like 2.83e-21
Family HRDC domain from helicases 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94985328|ref|YP_604692.1|
Sequence length 195
Comment hypothetical protein Dgeo_1226 [Deinococcus geothermalis DSM 11300]
Sequence
MVYGLSRRSVEETASWLQAQGVDALPYHAGLAPRERNLAQDRFLSEEGLIVVATVAFGIG
IDKPNVRFVAHLALPKSLEGYSQETPKARALLREDTFAPKPARRERARAPRKGGALVDHQ
DRPLFEALRQWRLAKAREQAVPPYVIFNDATLKIIAELRPGSLPTLDTVSGVETHKLEQY
GEDVLAVVRTHSGRR
Download sequence
Identical sequences Q1IZ11
319795.Dgeo_1226 gi|94985328|ref|YP_604692.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]