SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985335|ref|YP_604699.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985335|ref|YP_604699.1|
Domain Number 1 Region: 7-129
Classification Level Classification E-value
Superfamily Transcription factor NusA, N-terminal domain 4.19e-33
Family Transcription factor NusA, N-terminal domain 0.00021
Further Details:      
 
Domain Number 2 Region: 205-280
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 6.54e-28
Family Prokaryotic type KH domain (KH-domain type II) 0.00011
Further Details:      
 
Domain Number 3 Region: 134-202
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000048
Family Cold shock DNA-binding domain-like 0.0022
Further Details:      
 
Domain Number 4 Region: 284-343
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 0.000000000000412
Family Prokaryotic type KH domain (KH-domain type II) 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94985335|ref|YP_604699.1|
Sequence length 395
Comment transcription elongation factor NusA [Deinococcus geothermalis DSM 11300]
Sequence
MAQPEFNFADALREVAQARNINELQLIEAFEQSLAQAYSRNVEPDRRVEVHLDPVSGELE
VLIVREVVEKVEDENLQISLADALELDPGVEIGMEMEFPVDREKFSRIALQAAKQTLTQK
MRETERNVVYNEYKDREGQVLTAQVVRSDNKGNWFVELGAGEAILPPREQIPGEKLVPGN
RVKIYLKEVRKTPKGPTILASRADERLLEYLLRQEIPEVANGIVEIKAIAREAGQRSKVA
VYSHNPNVDPIGACIGHRGNRIQAVTGELGRERVDVILWDANARDFIRNALSPAKVGLIE
VRPDTREATVTVTPDQLSLAIGKGGQNVRLAAKLTGFKIDLRETAAIQDLDAAMQQALQE
EQGNTGPSSAAASAFDALFRDSKSVATASPDDEQE
Download sequence
Identical sequences Q1IZ04
319795.Dgeo_1234 gi|94985335|ref|YP_604699.1| WP_011530367.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]