SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985337|ref|YP_604701.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985337|ref|YP_604701.1|
Domain Number 1 Region: 102-275
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.43e-50
Family G proteins 0.0000872
Further Details:      
 
Domain Number 2 Region: 385-510
Classification Level Classification E-value
Superfamily Initiation factor IF2/eIF5b, domain 3 2.75e-33
Family Initiation factor IF2/eIF5b, domain 3 0.00094
Further Details:      
 
Domain Number 3 Region: 505-599
Classification Level Classification E-value
Superfamily Translation proteins 2.29e-26
Family Elongation factors 0.0000567
Further Details:      
 
Domain Number 4 Region: 277-359
Classification Level Classification E-value
Superfamily Translation proteins 2.21e-20
Family Elongation factors 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94985337|ref|YP_604701.1|
Sequence length 601
Comment translation initiation factor IF-2 [Deinococcus geothermalis DSM 11300]
Sequence
MSKVRIYTLAKDLGVDNAKMLEILDGLGVAYKSVSSTIEEDTVELIKQILEEEGHTASAE
PAPAQASGSPASPAQTEAQEAPQPTATATAEREPAAPPARELPHRAPVVTIMGHVDHGKT
SLLDYIRKTKVAAKEAGGITQHVGAFEAKTSKGKIVFIDTPGHEAFTTIRARGANVADIA
VIVIAADDSLMPQTREAIAHAQAAKVPMIVAINKVDLPQADPEKVKTDLTQLNLVPEEYG
GDLIVVPVSAKTGEGVEDLLEYISLTAELEDLRADPQGEFSGVIIESRVDRQAGVLATVM
VQEGTLHVGDFLVVGENYGKVKAMTDSNGGRIKEAGPSTPVQVLGFSEAPSSGEKVVSVK
NEHAARELVAQRVETRREAENARVQRKKTLEEMMGPLGETRTVNLILRADTQGSLEAIQG
ILARKETEDVKLNVMLAGIGSPTEGDVLLASTADATILCFNVTASGSVKKAAEQRDIELK
SFRIIYELIDEVDRLIKGNVEPVFEERPLGRAEVRMVIRHPKSGNIAGSYVTDGLLRRNA
KARVLRGKQVVYEGTIVGLKRFKDDVREVQAGYECGVNLDWNDVQEGDIIEASELVEVAQ
A
Download sequence
Identical sequences Q1IZ02
gi|94985337|ref|YP_604701.1| WP_011530369.1.71355 319795.Dgeo_1236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]