SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985386|ref|YP_604750.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985386|ref|YP_604750.1|
Domain Number 1 Region: 212-350
Classification Level Classification E-value
Superfamily CBS-domain pair 6.59e-36
Family CBS-domain pair 0.0022
Further Details:      
 
Domain Number 2 Region: 350-434
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 7.91e-23
Family CorC/HlyC domain-like 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94985386|ref|YP_604750.1|
Sequence length 446
Comment hypothetical protein Dgeo_1285 [Deinococcus geothermalis DSM 11300]
Sequence
MNDILGIVALFVLVLMNGFFVAAEFALVSVRRTRIDQLAEEGNSTARATQGALKNLDLYI
AATQLGITMASLAIGFVAEPAIEHLVHPLLGGTTLTQGQITAISFGVAFAISTILHIVFG
ELAPKSWALQRSEQVALLVTRPLLIFTGIFKWAIRGLNALGNGVVRLFGLQGVAGHHTAY
SEEEIRMIVSASSQEGVLEDDEKELVYNVFDLSETTVREVMTPRTEMVTVEATCPLRRLL
ELNAEHGYSRVPVYQDSADNVVGVAHTSDVLRYLDRLDETLIADVMHPVFFVPEGMKIND
LLAKMREKKSHMAIVVDEFGGTSGLVTLEDALEEIVGEIYDETDEEEQPLIEVLGEGIYL
MDASLTVGEVEERLGTNLEDGEGEYDTLSGFMTSHFGDIPEIGQSFVYGGWAFTVVDADQ
RRVTRVRVERAPTPNPLEPVEDPVHE
Download sequence
Identical sequences Q1IYV3
gi|94985386|ref|YP_604750.1| 319795.Dgeo_1285 WP_011530418.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]