SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94985402|ref|YP_604766.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985402|ref|YP_604766.1|
Domain Number 1 Region: 187-281
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 8.89e-16
Family Multidrug resistance efflux transporter EmrE 0.0065
Further Details:      
 
Domain Number 2 Region: 46-141
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000000000235
Family Multidrug resistance efflux transporter EmrE 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94985402|ref|YP_604766.1|
Sequence length 294
Comment hypothetical protein Dgeo_1301 [Deinococcus geothermalis DSM 11300]
Sequence
MRVPASLLILLAAVLWGLLGILGKNAQAAGVGPLEVAFWRAVLGGGLFALHTAVTRAPLP
RGRDLLVTAAFGLVGVSVFYGAYQLAVRAGGASLASVLLYTAPAFVALLGWGLLRERLGV
REGLAVAGTLMGIALISLGGGQGVNVTAAALTWGLLAGFTYSLYYLYGKAYFTRYPPTAL
YAVALPVGALGLLPFVAFSAKTPAAWGSLAGIAVLSTYFAYLAYSAGLRHLPATRASVIA
SLEPVVAAGLAALLFGERLSTTALLGAALVIGAALLLSLENSQAQPAPLPEEAP
Download sequence
Identical sequences Q1IYT7
gi|94985402|ref|YP_604766.1| WP_011530434.1.71355 319795.Dgeo_1301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]