SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985437|ref|YP_604801.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985437|ref|YP_604801.1|
Domain Number 1 Region: 7-396
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 4.84e-116
Family Homocysteine S-methyltransferase 0.0000066
Further Details:      
 
Domain Number 2 Region: 894-1202
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 3.66e-114
Family Methionine synthase SAM-binding domain 0.0000000555
Further Details:      
 
Domain Number 3 Region: 353-627
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 5.76e-85
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.001
Further Details:      
 
Domain Number 4 Region: 736-870
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 2.35e-43
Family Cobalamin (vitamin B12)-binding domain 0.00000239
Further Details:      
 
Domain Number 5 Region: 647-733
Classification Level Classification E-value
Superfamily Methionine synthase domain 4.71e-28
Family Methionine synthase domain 0.0000368
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94985437|ref|YP_604801.1|
Sequence length 1226
Comment B12-dependent methionine synthase [Deinococcus geothermalis DSM 11300]
Sequence
MADTRDIRAHARERILVLDGAWGTMLQRAGLTEADFRWPGADPLRMYRGNFDLLQLTRPD
VIQGVHRAYFEAGADIASTNTFNSTAISQADYGTEHLVRAMNEAGARLAREVADEFEARD
GRPRWVAGSVGPTNRTATLSPDVERPDFRNVTFDDLVAAYLEQLEGLIAGGADLILIETV
FDTLNAKAALFACEEAFARTGKRLPIMLSGTITDASGRTLSGQTPEAFVISTEHADLFSV
GLNCALGADLLRPHLRAIAANTAALVSVHPNAGLPNAFGEYDETPEHTAAVLRSFAEEGL
VNIVGGCCGTTPDHIRAIAAAVADLPPRTAPRLPPYLRLSGLEALTISPETNFVNVGERT
NVTGSPKFAKAILAGDYDAGLKIARQQVQNGAQLVDVNFDEGMLDGEAAMVKFLNLLAGE
PDISRVPLMLDSSRWEILEAGLKRVQGKCVVNSISLKDGEAKFLERGRLLRRYGAAAVVM
AFDEQGQADTLERRIEICSRAYRLLTEQAAFPPQDIIFDPNVLTVATGIEEHDRYALDFI
EATRWIKANLPGALVSGGISNVSFSFRGNNHVREAMHAVFLYHAIRAGLDMGIVNAGMLA
VYEDIEPELREAVEDVILARRPDATERLIQLAESYKDVKREAGAQSAWRELPVAERLKHA
LVSGITDYVVEDAEEAYQLLGSPLAVIEGPLMDGMNVVGDLFGAGKMFLPQVVKSARVMK
RAVAHLTPYLEAQKQEGGGKGKVLLATVKGDVHDIGKNIVGVVLACNGYQVTDLGVMVPA
EKILDTAQELGADVIGLSGLITPSLDEMVNVAREMTRRGLQTPLLIGGATTSRAHTAVKI
DPAYTGTVVHVLDASRAVGVVGDLLSQPDAVRARIREEYAALRERHGERQVRLIPLEQAR
ARAPRLSPALPPAPRERGRQVIEQPLAELLDYIDWTPFFIAWEMKGIYPGILTDPLRGAE
ARRLFDDAQALLQRIVKEGLLTARGVIGLWPARRVGDDILVEADNPTRLHTLRQQRDQST
PNTALADFVALRGDHIGAFAVAIHGAEELARSFEAQHDDYSAILVKSVADRLAEAFAEKL
HRDVRVRYWGYAPDEALGNHDLIKERYQGIRPAPGYPAQPDHTEKRTLFDLLQAEEVGLS
LTESGAMTPAAAVSGLYFAHPEAHYFAVGRIGRDQVEDYAARKGWTLAEAERWLGPILAY
DPTPPDFPPPSAAPLSPVPSVAGGRP
Download sequence
Identical sequences Q1IYQ2
319795.Dgeo_1336 WP_011530469.1.71355 gi|94985437|ref|YP_604801.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]