SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985524|ref|YP_604888.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985524|ref|YP_604888.1|
Domain Number 1 Region: 13-120
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 2.64e-20
Family DNA-binding N-terminal domain of transcription activators 0.0021
Further Details:      
 
Domain Number 2 Region: 125-264
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.0000209
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94985524|ref|YP_604888.1|
Sequence length 279
Comment MerR family transcriptional regulator [Deinococcus geothermalis DSM 11300]
Sequence
MVTEAQGPPEPLLTISHFARLSRLSPKALRLYDTLGLLRPLQVDPGSGYRFYAATQLEQA
RLIGLLRRLDMPLGQIQALIQAPVTDRAAQLQRYWQGLQRELQEKESLVAYLTDWFSQKE
TKMFEIQERTVGQVQVIGRRGRVHLGALPDFIATTFQELQQHLAAQDAPFAAAPYTLFYG
EVGADSDGPVEVCIPFCGRVVPGRGMTVRAEPAYREAYVTLTREQQGTVQAILTAHDEVA
RWLRQQGKTLARPAREVYLQSEGEQQPALEVAYAYRVES
Download sequence
Identical sequences Q1IYG5
WP_011530553.1.71355 gi|94985524|ref|YP_604888.1| 319795.Dgeo_1424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]