SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985553|ref|YP_604917.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985553|ref|YP_604917.1|
Domain Number 1 Region: 12-265
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.24e-68
Family G proteins 0.00000188
Further Details:      
 
Domain Number 2 Region: 464-578
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.45e-40
Family Translational machinery components 0.0000396
Further Details:      
 
Domain Number 3 Region: 253-383
Classification Level Classification E-value
Superfamily Translation proteins 8.72e-24
Family Elongation factors 0.00063
Further Details:      
 
Domain Number 4 Region: 579-669
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.02e-19
Family EF-G/eEF-2 domains III and V 0.00052
Further Details:      
 
Domain Number 5 Region: 388-463
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.0000000000000205
Family EF-G/eEF-2 domains III and V 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94985553|ref|YP_604917.1|
Sequence length 677
Comment elongation factor G [Deinococcus geothermalis DSM 11300]
Sequence
MPSESVVPENTPVRVVSLAGHSGAGKTTLAEALLVASGALLRAGRVTEGTTQSDHTDAEK
QHGFSITTGVLRLSQGGTDITLLDTPGYADFVREIRGGIRAADSVLMVVSAVSGVEVGTE
RVWATADRFEMPRLVVISKMDRERANFHAVLADLRASLRGPVAAAYLPVGEGPAFRGVVD
VLTAAPDELPGELRPALNEAREALVDAIVETDDDLMNRYLEGEAIGTEELRAALLRAVHA
GRLYPVVPVSAETGVGVPELLNLMVVGLRSASERGVLTGVDGQTREPTPNAPASARVWRV
SVDPFVGKLAYIRVWSGTIRPGDTLRNTTRGVDVKPAHLYVVSGKDLTEVSELRAGMIGV
LTKIPELHTGDTLADPAHPIEYDPLVLPDPAHTVALFPKTRQDEDRLSSAIGRLLDEDPT
LRFAREGQTGELLLSGMGDMHTTIAVEKLAALGVNVDTGVPQIPYRETIRAVSQAQGKHK
KQSGGHGQYGDCHLRVEPREGFSFCSEVVGGAIPGKYLPSIEKGVQDAMQKGPLAGYPMQ
DVHVAVTHGSYHDVDSSDLAFRTAGALAFRNAVEGAKPVLLEPVMLLKVRAPAQFTGDLI
GDLQTRRARVQGMDPAGTVITITAVVPQSELQTYSADLRSMTGDRGAFSVKPAGYQDLPE
HLAKKVIEARKAASLSS
Download sequence
Identical sequences Q1IYD6
319795.Dgeo_1453 WP_011530582.1.71355 gi|94985553|ref|YP_604917.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]