SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985573|ref|YP_604937.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985573|ref|YP_604937.1|
Domain Number 1 Region: 60-194
Classification Level Classification E-value
Superfamily Apolipoprotein 0.00000811
Family Apolipoprotein 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94985573|ref|YP_604937.1|
Sequence length 236
Comment late embryogenesis abundant protein [Deinococcus geothermalis DSM 11300]
Sequence
MSRREEHHFPLKRFLLLGALIGAVAYYFSREQNRRMLDQKLSELGLKDAAENVSDSVAKG
WEKTKDAAANAGHVIAEKATEVKDAVQQGGVQAGLDKAKDVADDAKGAVQQAAERVKDAV
QDAAATTKDQAQDVKNRVQDAADEAKHHVQQAAQQAKDQAQQTAQDVKHHLQNAADNAKD
SARQAANQAQQGMQQAQEKAQDVKQDTQRVVQDALNKGKEAANNIKSDLKDAERRM
Download sequence
Identical sequences Q1IYB6
319795.Dgeo_1473 gi|94985573|ref|YP_604937.1| WP_011530602.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]