SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985592|ref|YP_604956.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985592|ref|YP_604956.1|
Domain Number 1 Region: 49-317
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.82e-85
Family G proteins 0.000097
Further Details:      
 
Domain Number 2 Region: 301-429
Classification Level Classification E-value
Superfamily Translation proteins 3.09e-26
Family Elongation factors 0.0021
Further Details:      
 
Domain Number 3 Region: 432-503
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.000000000000169
Family EF-G/eEF-2 domains III and V 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94985592|ref|YP_604956.1|
Sequence length 567
Comment peptide chain release factor 3 [Deinococcus geothermalis DSM 11300]
Sequence
MSEWCISSRPRSASRRCRVFLRCLSFKPGILVCPQECSVTIPTAQLEHEITRRRTFAIIS
HPDAGKTTITEKLLLYGGAIQEAGSVTAKEGRAHTKSDWMSIEQQRGISISSSALTFEYA
GRHINLLDTPGHQDFSEDTYRTLTAADSALMVLDAARGVQSQTEKLFAVCRNRGIPILTF
VNKMDRPALDPFELLAQVENTLKITAVPLTWPIGDGPDFKGVYDLQTGQVLVFERTSGGK
HRAPVQTAGLTDPQLAELVGPDLAAKLQEDVDLIRGAMPEFDPAAFRSGELTPVFFGSAM
NNFGVEHFLANFVELAPPPGPVETNLGKRAPDAPFAGFIFKLQANMSRAHRDRTAYMRVM
SGHFTRGMDVTHTRTGRKLRLSQAHTLFAQDREKVEEAYPGDIVGLVNPGVFQIGDVVSV
DPKVTLPSFPRFTPETFATLSLRDVGKRKAFMKGLTQLAEEGVVQVFYPTDGARDPYLGA
VGPLQFEVFQARLQEEYGVEVDLHVTGYQLVRWLAGDPGSVARFARHVEDDQGRPVMLFR
SRYDLEYTAEQHPEIEFLPLPKDLTRV
Download sequence
Identical sequences Q1IY97
319795.Dgeo_1492 WP_011530621.1.71355 gi|94985592|ref|YP_604956.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]