SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985607|ref|YP_604971.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985607|ref|YP_604971.1|
Domain Number 1 Region: 248-536
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.57e-92
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000301
Further Details:      
 
Domain Number 2 Region: 66-245
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 6.93e-53
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0000114
Further Details:      
 
Domain Number 3 Region: 539-644
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 8.61e-27
Family Anticodon-binding domain of Class II aaRS 0.00026
Further Details:      
 
Domain Number 4 Region: 2-60
Classification Level Classification E-value
Superfamily TGS-like 0.0000000000000181
Family TGS domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94985607|ref|YP_604971.1|
Sequence length 649
Comment threonyl-tRNA synthetase [Deinococcus geothermalis DSM 11300]
Sequence
MHVTLPDGKQLDLQAGATALDVARALGPRLAQDALAALVNGELMDLMTPLPEGAQVRLIT
KKNPGDAAPVFRHSLGHVLSQAVGEFYQRKGYPREAVKRGVGPAIENGFYQDFDLPEPLK
EEDLPEIEAIMREIIGRGLDIVRQDVGKAAALKHFSYDPYKVELIQELPENEPVTFYAQG
DYVDLCRGPHFPNTGKLPGAFKLMSTSGAYWRGNEKNPILQRVYGVAFATQKELDEYLER
LEEARRRDHRKLGRELELFLIDPLVGKGLPMWLPNGTVLREELTRFLREQQFQRDYQGVV
TPNIGNLDLFRTSGHYPYYSDSQFEPLSVDEEQYMLKPMNCPFHIRIYASKPRSYRDLPV
RLAEFGTVYRYEMSGELNGLTRVRGFTQDDAHIFARPDQLKKEFLDVLDLTVLVLKTFGM
NDVRFRVGVRDPASDKYVGDPAQWEVAERQIIEAVEEVGLPYTVEPGDAAFYGPKLDFVV
KDVLGREWQLGTIQVDYNLPERFDLTYTGEDGQEHRPVMIHRAPFGSLERFVGILIEHYG
GDFPFWLAPRQIMLIPIADRHNAYAQTLANEFKAAGLRAEVDDSNNRMNAKVRNAELHKI
PVMLIVGDQEEARREVSVRERTPEGHKERKGVDFTALLAELQERYRTRA
Download sequence
Identical sequences Q1IY82
WP_011530636.1.71355 gi|94985607|ref|YP_604971.1| 319795.Dgeo_1507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]