SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94985609|ref|YP_604973.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985609|ref|YP_604973.1|
Domain Number 1 Region: 87-171
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, C-terminal domain 8.89e-30
Family Translation initiation factor IF3, C-terminal domain 0.0000252
Further Details:      
 
Domain Number 2 Region: 8-81
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, N-terminal domain 6.93e-28
Family Translation initiation factor IF3, N-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94985609|ref|YP_604973.1|
Sequence length 204
Comment translation initiation factor IF-3 [Deinococcus geothermalis DSM 11300]
Sequence
MIDIAKEHKVNEQIRVRQIRLIGAEGEQIGIIDTRDALAMAREKGLDLVMVSPQAVPPVC
RLLDYGRFRYEQQQNEKENRKRARAQEVKAIKFRVKIDDHDFNTKTGHVRRFLEEGHKVK
VTIMFRGRERTHPELGERILHRVAETLADIGAPEGMPSMMGMDMNMIMVPKAAPKRDSGR
SESAQEAPTARSAEASRPEAPANA
Download sequence
Identical sequences Q1IY80
gi|94985609|ref|YP_604973.1| 319795.Dgeo_1509 WP_011530638.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]